Recombinant Human PHBP19 Protein, GST-tagged

• Cat.No.: PHBP19-4777H
• Product Overview: Human LOC494150 full-length ORF ( AAH14228.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PHBP19 (Prohibitin Pseudogene 19) is a Pseudogene.
• Molecular Mass: 48.5 kDa
• AA Sequence: MGTETNYLCLSPPRNVPIITGSKDLQNVNITLRIIFQPVASQLPRIFTSIGEDYDEPVLTYITTEILKSVVARFDAGEVITQRELVSRQVSNDLTEQAATFGLILDDVSLTYLTFGKEFTEAVEAKQVAQQEAERARFVKEKAEQQKKAEQQKKVEQQKKAAVISAEGDSKATELIVNSLATAGDGLMELCKLEAAEALGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PHBP19 prohibitin pseudogene 19 [ Homo sapiens (human) ]
• Official Symbol: PHBP19
• Synonyms: PHBP19; prohibitin pseudogene 19
• Gene ID: 494150