Recombinant Human PHLPP2 protein, His-tagged

Species :	Human
Source :	E.coli
Tag :	His
Protein Length :	575-781 aa
Form :	The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence :	LDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTS
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Name	PHLPP2 PH domain and leucine rich repeat protein phosphatase 2 [ Homo sapiens ]
Official Symbol	PHLPP2
Synonyms	PHLPP2; PH domain and leucine rich repeat protein phosphatase 2; PH domain and leucine rich repeat protein phosphatase like , PHLPPL; PH domain leucine-rich repeat-containing protein phosphatase 2; KIAA0931; PHLPPL;
Gene ID	23035
mRNA Refseq	NM_015020
Protein Refseq	NP_055835
MIM	611066
UniProt ID	Q6ZVD8