Recombinant Human PICK1 protein, His-tagged
| Cat.No. : | PICK1-3054H |
| Product Overview : | Recombinant Human PICK1 protein(1-415 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-415 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PICK1 protein interacting with PRKCA 1 [ Homo sapiens ] |
| Official Symbol | PICK1 |
| Synonyms | PICK1; protein interacting with PRKCA 1; PRKCABP, protein interacting with PRKCA , protein kinase C, alpha binding protein; PRKCA-binding protein; dJ1039K5; MGC15204; protein interacting with C kinase 1; protein kinase C-alpha-binding protein; PICK; PRKCABP; |
| Gene ID | 9463 |
| mRNA Refseq | NM_001039583 |
| Protein Refseq | NP_001034672 |
| MIM | 605926 |
| UniProt ID | Q9NRD5 |
| ◆ Recombinant Proteins | ||
| PICK1-4692Z | Recombinant Zebrafish PICK1 | +Inquiry |
| PICK1-3423R | Recombinant Rhesus monkey PICK1 Protein, His-tagged | +Inquiry |
| PICK1-4445R | Recombinant Rat PICK1 Protein | +Inquiry |
| Pick1-4853M | Recombinant Mouse Pick1 Protein, Myc/DDK-tagged | +Inquiry |
| PICK1-4063H | Recombinant Human PICK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PICK1-3198HCL | Recombinant Human PICK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PICK1 Products
Required fields are marked with *
My Review for All PICK1 Products
Required fields are marked with *
