Recombinant Human PITPNM2 protein, GST-tagged

• Cat.No.: PITPNM2-1734H
• Product Overview: Recombinant Human PITPNM2 protein(233-328 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 233-328 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: EWYGLSMENIRELEKEAQLMLSRKMAQFNEDGEEATELVKHEAVSDQTSGEPPEPSSSNGEPLVGRGLKKQWSTSSKSSRSSKRGASPSRHSISEW
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PITPNM2 phosphatidylinositol transfer protein, membrane-associated 2 [ Homo sapiens ]
• Official Symbol: PITPNM2
• Synonyms: PITPNM2; phosphatidylinositol transfer protein, membrane-associated 2; membrane-associated phosphatidylinositol transfer protein 2; NIR3; RDGB2; RDGBA2; PITPnm 2; retinal degeneration B alpha 2; PYK2 N-terminal domain-interacting receptor 3; NIR-3; KIAA1457
• Gene ID: 57605
• mRNA Refseq: NM_020845
• Protein Refseq: NP_065896
• MIM: 608920
• UniProt ID: Q9BZ72