"PLS3" Related Products

Expand
Expand
Expand

Recombinant Human PLS3 protein, T7/His-tagged

Cat.No. : PLS3-120H
Product Overview : Recombinant human T-plastin-3 cDNA (629 aa, T-isoform, derived from BC039049) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMP LPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYS EEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENL NLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEEL LLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKL GCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYAD LQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLAL VWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLV KSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name : PLS3 plastin 3 [ Homo sapiens ]
Official Symbol : PLS3
Synonyms : PLS3; plastin 3; plastin 3 (T isoform); plastin-3; T plastin; T fimbrin; T-plastin; DKFZp686G1497;
Gene ID : 5358
mRNA Refseq : NM_001136025
Protein Refseq : NP_001129497
MIM : 300131
UniProt ID : P13797
Chromosome Location : Xq23
Function : actin binding; calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.