Recombinant Human POLE3 protein, GST-tagged
| Cat.No. : | POLE3-1220H |
| Product Overview : | Recombinant Human POLE3 protein(1-147 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-147 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) [ Homo sapiens ] |
| Official Symbol | POLE3 |
| Synonyms | POLE3; polymerase (DNA directed), epsilon 3 (p17 subunit); DNA polymerase epsilon subunit 3; arsenic transactivated protein; CHARAC17; CHRAC17; chromatin accessibility complex 17; DNA polymerase epsilon p17 subunit; histone fold protein CHRAC17; p17; Ybl1; asTP; CHRAC-17; huCHRAC17; DNA polymerase II subunit 3; arsenic-transactivated protein; DNA polymerase epsilon subunit p17; chromatin accessibility complex 17 kDa protein; YBL1; |
| Gene ID | 54107 |
| mRNA Refseq | NM_017443 |
| Protein Refseq | NP_059139 |
| MIM | 607267 |
| UniProt ID | Q9NRF9 |
| ◆ Recombinant Proteins | ||
| POLE3-4564R | Recombinant Rat POLE3 Protein | +Inquiry |
| POLE3-11057Z | Recombinant Zebrafish POLE3 | +Inquiry |
| POLE3-397H | Recombinant Human POLE3, His-tagged | +Inquiry |
| POLE3-13076M | Recombinant Mouse POLE3 Protein | +Inquiry |
| POLE3-7630H | Recombinant Human POLE3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLE3-1391HCL | Recombinant Human POLE3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLE3 Products
Required fields are marked with *
My Review for All POLE3 Products
Required fields are marked with *
