Recombinant Human POLK, GST-tagged
| Cat.No. : | POLK-765H |
| Product Overview : | Human POLK full-length ORF ( AAH50718, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass. |
| Molecular Mass : | 77.66 kDa |
| AA Sequence : | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQIT SQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKM GSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | POLK polymerase (DNA directed) kappa [ Homo sapiens (human) ] |
| Official Symbol | POLK |
| Synonyms | POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; EC 2.7.7.7 |
| Gene ID | 51426 |
| mRNA Refseq | NM_016218 |
| Protein Refseq | NP_057302 |
| MIM | 605650 |
| UniProt ID | Q9UBT6 |
| Chromosome Location | 5q13 |
| Pathway | Fanconi anemia pathway |
| Function | DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLK Products
Required fields are marked with *
My Review for All POLK Products
Required fields are marked with *
