Recombinant Human POLR2H Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POLR2H-914H |
Product Overview : | POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POLR2H RNA polymerase II, I and III subunit H [ Homo sapiens (human) ] |
Official Symbol | POLR2H |
Synonyms | POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; DNA-directed RNA polymerases I, II, and III subunit RPABC3; RPB8; hRPB8; RPB8 homolog; DNA-directed RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; RPB17; RPABC3; hsRPB8; |
Gene ID | 5437 |
mRNA Refseq | NM_006232 |
Protein Refseq | NP_006223 |
MIM | 606023 |
UniProt ID | P52434 |
◆ Recombinant Proteins | ||
POLR2H-2374Z | Recombinant Zebrafish POLR2H | +Inquiry |
POLR2H-914H | Recombinant Human POLR2H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Polr2h-4999M | Recombinant Mouse Polr2h Protein, Myc/DDK-tagged | +Inquiry |
POLR2H-13098M | Recombinant Mouse POLR2H Protein | +Inquiry |
POLR2H-556H | Recombinant Human polymerase (RNA) II (DNA directed) polypeptide H, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2H-3031HCL | Recombinant Human POLR2H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2H Products
Required fields are marked with *
My Review for All POLR2H Products
Required fields are marked with *