Recombinant Human POLR2J3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR2J3-5216H
• Product Overview: POLR2J3 MS Standard C13 and N15-labeled recombinant protein (NP_001091084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo.
• Molecular Mass: 12.9 kDa
• AA Sequence: MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR2J3 RNA polymerase II subunit J3 [ Homo sapiens (human) ]
• Official Symbol: POLR2J3
• Synonyms: POLR2J3; polymerase (RNA) II (DNA directed) polypeptide J3; POLR2J2; RPB11b1; RPB11b2; DNA-directed RNA polymerase II subunit RPB11-b2; RNA polymerase II subunit B11-b2; DNA-directed RNA polymerase II subunit 11; DNA-directed RNA polymerase II subunit J3
• Gene ID: 548644
• mRNA Refseq: NM_001097615
• Protein Refseq: NP_001091084
• UniProt ID: Q9GZM3