Recombinant Human PPARGLBD Protein, GST-tagged

Cat.No. : PPARGLBD-325H
Product Overview : Recombinant Human PPARGLBD Protein (aa 201-477) is produced by baculovirus-infected insect cells expression system. This protein is fused with a GST tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : GST
Protein Length : aa 201-477
Description : Peroxisome proliferator-activated receptor gamma (PPAR-γ or PPARG) is also known as the glitazone receptor, or NR1C3 (nuclear receptor subfamily 1, group C, member 3). GST-tagged Peroxisome proliferator-activated receptor gamma ligand-binding domain (PPARG-LBD) consists of a 218 a.a. GST tag. PPARG-LBD was produced in the absence of detergents and exogenous ligands to ensure advanced performance in ligand-binding assays and coregulator displacement studies.
Form : 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 7 mM reduced glutathione, 20% glycerol.
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWENKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Purity : >90%
Applications : Ligand binding and coactivator peptide recruitment assays.
Notes : Avoid freeze-thaw cycles. While working, please keep sample on ice.
Storage : Immediately store at -80 centigrade.
Gene Name PPARG peroxisome proliferator-activated receptor gamma [ Homo sapiens ]
Official Symbol PPARG
Synonyms PPARG; NR1C3; PPARG1; PPARG2; PPARgamma; PPAR gamma; PPAR-gamma; GLM1; CIMT1;
Gene ID 5468
mRNA Refseq NM_005037
Protein Refseq NP_005028
MIM 601487
UniProt ID P37231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPARGLBD Products

Required fields are marked with *

My Review for All PPARGLBD Products

Required fields are marked with *

0
cart-icon