Recombinant Human PPIE protein, T7-tagged
| Cat.No. : | PPIE-180H |
| Product Overview : | Recombinant human PPIE (301aa, isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 301 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKK ARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKD GKPKQKVIIADCGEYV |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | PPIE peptidylprolyl isomerase E (cyclophilin E) [ Homo sapiens ] |
| Official Symbol | PPIE |
| Synonyms | PPIE; cyclophilin 33; cyclophilin E; CyP 33; MGC3736; MGC111222; PPIase E; rotamase E; cyclophilin-33; CYP33; CYP-33; |
| Gene ID | 10450 |
| mRNA Refseq | NM_001195007 |
| Protein Refseq | NP_001181936 |
| MIM | 602435 |
| UniProt ID | Q9UNP9 |
| Chromosome Location | 1p32 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
| Function | RNA binding; RNA binding; cyclosporin A binding; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| PPIE-2438Z | Recombinant Zebrafish PPIE | +Inquiry |
| Ppie-5042M | Recombinant Mouse Ppie Protein, Myc/DDK-tagged | +Inquiry |
| PPIE-1685H | Recombinant Human PPIE Protein (Met1-Val301), N-His tagged | +Inquiry |
| PPIE-6982M | Recombinant Mouse PPIE Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPIE-26336TH | Recombinant Human PPIE, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIE-2971HCL | Recombinant Human PPIE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIE Products
Required fields are marked with *
My Review for All PPIE Products
Required fields are marked with *
