Recombinant Human PPIE protein, T7-tagged

Cat.No. : PPIE-180H
Product Overview : Recombinant human PPIE (301aa, isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 301 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKK ARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKD GKPKQKVIIADCGEYV
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name PPIE peptidylprolyl isomerase E (cyclophilin E) [ Homo sapiens ]
Official Symbol PPIE
Synonyms PPIE; cyclophilin 33; cyclophilin E; CyP 33; MGC3736; MGC111222; PPIase E; rotamase E; cyclophilin-33; CYP33; CYP-33;
Gene ID 10450
mRNA Refseq NM_001195007
Protein Refseq NP_001181936
MIM 602435
UniProt ID Q9UNP9
Chromosome Location 1p32
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function RNA binding; RNA binding; cyclosporin A binding; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIE Products

Required fields are marked with *

My Review for All PPIE Products

Required fields are marked with *

0
cart-icon