"PPIE" Related Products

Expand

Recombinant Human PPIE protein, T7-tagged

Cat.No.: PPIE-180H
Product Overview: Recombinant human PPIE (301aa, isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKK ARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKD GKPKQKVIIADCGEYV
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: PPIE peptidylprolyl isomerase E (cyclophilin E) [ Homo sapiens ]
Official Symbol: PPIE
Synonyms: PPIE; cyclophilin 33; cyclophilin E; CyP 33; MGC3736; MGC111222; PPIase E; rotamase E; cyclophilin-33; CYP33; CYP-33;
Gene ID: 10450
mRNA Refseq: NM_001195007
Protein Refseq: NP_001181936
MIM: 602435
UniProt ID: Q9UNP9
Chromosome Location: 1p32
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function: RNA binding; RNA binding; cyclosporin A binding; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.