Recombinant Human PPIE protein, T7-tagged
Cat.No. : | PPIE-180H |
Product Overview : | Recombinant human PPIE (301aa, isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 301 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKK ARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKD GKPKQKVIIADCGEYV |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | PPIE peptidylprolyl isomerase E (cyclophilin E) [ Homo sapiens ] |
Official Symbol | PPIE |
Synonyms | PPIE; cyclophilin 33; cyclophilin E; CyP 33; MGC3736; MGC111222; PPIase E; rotamase E; cyclophilin-33; CYP33; CYP-33; |
Gene ID | 10450 |
mRNA Refseq | NM_001195007 |
Protein Refseq | NP_001181936 |
MIM | 602435 |
UniProt ID | Q9UNP9 |
Chromosome Location | 1p32 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
Function | RNA binding; RNA binding; cyclosporin A binding; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; |
◆ Recombinant Proteins | ||
PPIE-1685H | Recombinant Human PPIE Protein (Met1-Val301), N-His tagged | +Inquiry |
PPIE-118H | Recombinant Human Peptidylprolyl isomerase E isoform 1, His-tagged | +Inquiry |
PPIE-2438Z | Recombinant Zebrafish PPIE | +Inquiry |
PPIE-1885H | Recombinant Human PPIE, GST-tagged | +Inquiry |
PPIE-13183M | Recombinant Mouse PPIE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIE-2971HCL | Recombinant Human PPIE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIE Products
Required fields are marked with *
My Review for All PPIE Products
Required fields are marked with *