Recombinant Human PPP4C

• Cat.No.: PPP4C-29539TH
• Product Overview: Recombinant fragment of Human PPP4C with N terminal proprietary tag, predicted mwt: 35.53 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Serine/threonine-protein phosphatase 4 catalytic subunit is an enzyme that in humans is encoded by the PPP4C gene.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
• Sequence Similarities: Belongs to the PPP phosphatase family. PP-4 (PP-X) subfamily.

Gene Information

• Gene Name: PPP4C protein phosphatase 4, catalytic subunit [ Homo sapiens ]
• Official Symbol: PPP4C
• Synonyms: PPP4C; protein phosphatase 4, catalytic subunit; protein phosphatase 4 (formerly X), catalytic subunit; serine/threonine-protein phosphatase 4 catalytic subunit; PP4; PPX; protein phosphatase X; catalytic subunit
• Gene ID: 5531
• mRNA Refseq: NM_002720
• Protein Refseq: NP_002711
• MIM: 602035
• Uniprot ID: P60510
• Chromosome Location: 16p11.2
• Function: NF-kappaB-inducing kinase activity; hydrolase activity; metal ion binding; protein binding; protein serine/threonine phosphatase activity