Recombinant Human PPY Protein, His-tagged
Cat.No. : | PPY-214H |
Product Overview : | Recombinant Human PPY fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-88 a.a. |
Description : | The physiological role for the icosapeptide has not yet been elucidated. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 7.8kD |
AA Sequence : | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PPY pancreatic polypeptide [ Homo sapiens ] |
Official Symbol | PPY |
Synonyms | PPY; pancreatic polypeptide; pancreatic prohormone; pancreatic polypeptide Y; PNP; PP; |
Gene ID | 5539 |
mRNA Refseq | NM_002722 |
Protein Refseq | NP_002713 |
MIM | 167780 |
UniProt ID | P01298 |
◆ Recombinant Proteins | ||
Ppy-5089M | Recombinant Mouse Ppy Protein, Myc/DDK-tagged | +Inquiry |
PPY-4308R | Recombinant Rat PPY Protein, His (Fc)-Avi-tagged | +Inquiry |
PPY-6742H | Recombinant Human PPY protein, His & GST-tagged | +Inquiry |
PPY-13285M | Recombinant Mouse PPY Protein | +Inquiry |
PPY-4649R | Recombinant Rat PPY Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPY-1408HCL | Recombinant Human PPY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPY Products
Required fields are marked with *
My Review for All PPY Products
Required fields are marked with *