Recombinant Human PPY Protein, His-tagged

Cat.No. : PPY-214H
Product Overview : Recombinant Human PPY fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 30-88 a.a.
Description : The physiological role for the icosapeptide has not yet been elucidated.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
Molecular Mass : 7.8kD
AA Sequence : APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PPY pancreatic polypeptide [ Homo sapiens ]
Official Symbol PPY
Synonyms PPY; pancreatic polypeptide; pancreatic prohormone; pancreatic polypeptide Y; PNP; PP;
Gene ID 5539
mRNA Refseq NM_002722
Protein Refseq NP_002713
MIM 167780
UniProt ID P01298

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPY Products

Required fields are marked with *

My Review for All PPY Products

Required fields are marked with *

0
cart-icon