Recombinant Human PRDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRDX1-3543H
Product Overview : PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene.
Molecular Mass : 22.1 kDa
AA Sequence : MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRDX1 peroxiredoxin 1 [ Homo sapiens (human) ]
Official Symbol PRDX1
Synonyms PRDX1; peroxiredoxin 1; PAGA; peroxiredoxin-1; NKEFA; NKEF-A; thioredoxin peroxidase 2; proliferation-associated gene A; natural killer-enhancing factor A; proliferation-associated gene protein; natural killer cell-enhancing factor A; thioredoxin-dependent peroxide reductase 2; PAG; PAGB; PRX1; PRXI; MSP23; TDPX2;
Gene ID 5052
mRNA Refseq NM_181697
Protein Refseq NP_859048
MIM 176763
UniProt ID Q06830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX1 Products

Required fields are marked with *

My Review for All PRDX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon