Recombinant Human Full Length PRL protein, His-tagged
| Cat.No. : | PRL-2590H |
| Product Overview : | Recombinant Human Full Length PRL protein(29-227 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-227 aa |
| Form : | 10mM PBS, pH 7.4. |
| Molecular Mass : | The recombinant human Full Length PRL protein consists of 213 amino acids and predicts a molecular mass of 24.46 kDa. |
| AASequence : | GAGATVEFHHHHHHLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 3.15mg/ml |
| Gene Name | PRL prolactin [ Homo sapiens ] |
| Official Symbol | PRL |
| Synonyms | PRL; prolactin; decidual prolactin; |
| Gene ID | 5617 |
| mRNA Refseq | NM_000948 |
| Protein Refseq | NP_000939 |
| MIM | 176760 |
| UniProt ID | P01236 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
Recently Viewed
