Recombinant Human PRLR protein, GST-tagged

Cat.No. : PRLR-59H
Product Overview : Recombinant Human PRLR(1 a.a. - 622 a.a.) fused with GST tag at N-terminal was expressed in NS0.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 622 a.a.
Description : This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 95.9 kDa
AA Sequence : MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHEC PDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIK WSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQ IPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFY DPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATL LNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLP KQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS KCRLQLGGLDYLDPACFTHSFH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PRLR prolactin receptor [ Homo sapiens ]
Official Symbol PRLR
Synonyms PRLR; prolactin receptor; PRL-R; hPRL receptor; secreted prolactin binding protein; hPRLrI;
Gene ID 5618
mRNA Refseq NM_000949
Protein Refseq NP_000940
MIM 176761
UniProt ID P16471
Chromosome Location 5p14-p13
Pathway Adipogenesis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ErbB4 signaling events, organism-specific biosystem; Growth hormone receptor signaling, organism-specific biosystem; Immune System, organism-specific biosystem;
Function cytokine receptor activity; metal ion binding; ornithine decarboxylase activator activity; peptide hormone binding; prolactin receptor activity; protein homodimerization activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRLR Products

Required fields are marked with *

My Review for All PRLR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon