"PRMT3" Related Products

Expand
Expand
Expand

Recombinant Human PRMT3 protein, T7/His-tagged

Cat.No.: PRMT3-119H
Product Overview: Recombinant human PRMT3 cDNA (465aa, derived from BC001878, isoform 1) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQG^GEFCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQ QTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYL KPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMH TDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLY AKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKH IDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAG EALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human PRMT3 functional regulations using protein mediated intracellular dilivery study.2. May be used for specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: PRMT3 protein arginine methyltransferase 3 [ Homo sapiens ]
Official Symbol: PRMT3
Synonyms: PRMT3; protein arginine methyltransferase 3; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HRMT1L3
Gene ID: 10196
mRNA Refseq: NM_001145166
Protein Refseq: NP_001138638
MIM: 603190
UniProt ID: O60678
Chromosome Location: 11p15.1
Function: metal ion binding; protein-arginine N-methyltransferase activity; protein-arginine omega-N asymmetric methyltransferase activity; transferase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.