Recombinant Human PRPF19, His-tagged
| Cat.No. : | PRPF19-30592TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 235-504 of Human PRP19 with an N terminal His tag. Predicted mwt: 31 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 235-504 a.a. |
| Description : | PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHP SQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGL SLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFK TLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWT EILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL |
| Gene Name | PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | PRPF19 |
| Synonyms | PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; |
| Gene ID | 27339 |
| mRNA Refseq | NM_014502 |
| Protein Refseq | NP_055317 |
| MIM | 608330 |
| Uniprot ID | Q9UMS4 |
| Chromosome Location | 11q12.2 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; |
| Function | DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-ubiquitin ligase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPF19 Products
Required fields are marked with *
My Review for All PRPF19 Products
Required fields are marked with *



