Recombinant Human PRPS1 protein, His-SUMO-tagged
| Cat.No. : | PRPS1-3372H |
| Product Overview : | Recombinant Human PRPS1 protein(P60891)(2-318aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-318aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRPS1 phosphoribosyl pyrophosphate synthetase 1 [ Homo sapiens ] |
| Official Symbol | PRPS1 |
| Synonyms | PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital , DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1; deafness 2, perceptive, congenital; ribose-phosphate diphosphokinase 1; phosphoribosyl pyrophosphate synthase I; deafness, X-linked 2, perceptive, congenital; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); ARTS; DFN2; PRSI; PRS-I; PPRibP; KIAA0967; |
| Gene ID | 5631 |
| mRNA Refseq | NM_001204402 |
| Protein Refseq | NP_001191331 |
| MIM | 311850 |
| UniProt ID | P60891 |
| ◆ Recombinant Proteins | ||
| PRPS1-494H | Recombinant Human PRPS1, His-tagged | +Inquiry |
| PRPS1-4723R | Recombinant Rat PRPS1 Protein | +Inquiry |
| PRPS1-4382R | Recombinant Rat PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRPS1-1982H | Recombinant Human PRPS1, His-tagged | +Inquiry |
| PRPS1-13460M | Recombinant Mouse PRPS1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRPS1-2820HCL | Recombinant Human PRPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS1 Products
Required fields are marked with *
My Review for All PRPS1 Products
Required fields are marked with *
