Recombinant Human PRPS1 protein, His-SUMO-tagged

Cat.No. : PRPS1-3372H
Product Overview : Recombinant Human PRPS1 protein(P60891)(2-318aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-318aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.7 kDa
AA Sequence : PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PRPS1 phosphoribosyl pyrophosphate synthetase 1 [ Homo sapiens ]
Official Symbol PRPS1
Synonyms PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital , DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1; deafness 2, perceptive, congenital; ribose-phosphate diphosphokinase 1; phosphoribosyl pyrophosphate synthase I; deafness, X-linked 2, perceptive, congenital; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); ARTS; DFN2; PRSI; PRS-I; PPRibP; KIAA0967;
Gene ID 5631
mRNA Refseq NM_001204402
Protein Refseq NP_001191331
MIM 311850
UniProt ID P60891

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRPS1 Products

Required fields are marked with *

My Review for All PRPS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon