Recombinant Human PRPS1 protein, His-SUMO-tagged
Cat.No. : | PRPS1-3372H |
Product Overview : | Recombinant Human PRPS1 protein(P60891)(2-318aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-318aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PRPS1 phosphoribosyl pyrophosphate synthetase 1 [ Homo sapiens ] |
Official Symbol | PRPS1 |
Synonyms | PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital , DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1; deafness 2, perceptive, congenital; ribose-phosphate diphosphokinase 1; phosphoribosyl pyrophosphate synthase I; deafness, X-linked 2, perceptive, congenital; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); ARTS; DFN2; PRSI; PRS-I; PPRibP; KIAA0967; |
Gene ID | 5631 |
mRNA Refseq | NM_001204402 |
Protein Refseq | NP_001191331 |
MIM | 311850 |
UniProt ID | P60891 |
◆ Recombinant Proteins | ||
PRPS1-7150M | Recombinant Mouse PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPS1-3444R | Recombinant Rhesus Macaque PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prps1-5152M | Recombinant Mouse Prps1 Protein, Myc/DDK-tagged | +Inquiry |
PRPS1-3626R | Recombinant Rhesus monkey PRPS1 Protein, His-tagged | +Inquiry |
PRPS1-814C | Recombinant Cynomolgus PRPS1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS1-2820HCL | Recombinant Human PRPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS1 Products
Required fields are marked with *
My Review for All PRPS1 Products
Required fields are marked with *