Recombinant Human PRR13 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRR13-5514H
• Product Overview: PRR13 MS Standard C13 and N15-labeled recombinant protein (NP_060927) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRR13 (Proline Rich 13) is a Protein Coding gene.
• Molecular Mass: 15.4 kDa
• AA Sequence: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRR13 proline rich 13 [ Homo sapiens (human) ]
• Official Symbol: PRR13
• Synonyms: PRR13; proline rich 13; proline-rich protein 13; DKFZP564J157; FLJ23818; taxane-resistance protein; TXR1; FLJ58476; DKFZp564J157
• Gene ID: 54458
• mRNA Refseq: NM_018457
• Protein Refseq: NP_060927
• MIM: 610459
• UniProt ID: Q9NZ81