Recombinant Human PRSS21 Protein (42-288 aa), His-tagged
| Cat.No. : | PRSS21-2245H |
| Product Overview : | Recombinant Human PRSS21 Protein (42-288 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 42-288 aa |
| Description : | Could regulate proteolytic events associated with testicular germ cell maturation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.8 kDa |
| AA Sequence : | IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | PRSS21 protease, serine, 21 (testisin) [ Homo sapiens ] |
| Official Symbol | PRSS21 |
| Synonyms | PRSS21; testisin; ESP 1; TEST1; TESTISIN; serine protease 21; ESP1; ESP-1; |
| Gene ID | 10942 |
| mRNA Refseq | NM_006799 |
| Protein Refseq | NP_006790 |
| MIM | 608159 |
| UniProt ID | Q9Y6M0 |
| ◆ Recombinant Proteins | ||
| Prss21-1994R | Recombinant Rat Prss21 Protein, His-tagged | +Inquiry |
| PRSS21-583M | Recombinant Mouse PRSS21 protein, His-tagged | +Inquiry |
| PRSS21-2630H | Recombinant Human PRSS21 Protein, His-tagged | +Inquiry |
| PRSS21-5132H | Recombinant Human PRSS21 protein, His&Myc-tagged | +Inquiry |
| PRSS21-2245H | Recombinant Human PRSS21 Protein (42-288 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS21-2805HCL | Recombinant Human PRSS21 293 Cell Lysate | +Inquiry |
| PRSS21-2804HCL | Recombinant Human PRSS21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS21 Products
Required fields are marked with *
My Review for All PRSS21 Products
Required fields are marked with *
