Recombinant Human PRSS21 Protein (42-288 aa), His-tagged

Cat.No. : PRSS21-2245H
Product Overview : Recombinant Human PRSS21 Protein (42-288 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 42-288 aa
Description : Could regulate proteolytic events associated with testicular germ cell maturation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.8 kDa
AA Sequence : IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name PRSS21 protease, serine, 21 (testisin) [ Homo sapiens ]
Official Symbol PRSS21
Synonyms PRSS21; testisin; ESP 1; TEST1; TESTISIN; serine protease 21; ESP1; ESP-1;
Gene ID 10942
mRNA Refseq NM_006799
Protein Refseq NP_006790
MIM 608159
UniProt ID Q9Y6M0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS21 Products

Required fields are marked with *

My Review for All PRSS21 Products

Required fields are marked with *

0
cart-icon
0
compare icon