Recombinant Human PSG6, His-tagged
Cat.No. : | PSG6-182H |
Product Overview : | Recombinant Human Pregnancy-Specific β-1-Glycoprotein 6/PSG6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln35-His424) of Human PSG6 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 35-424 a.a. |
Description : | Pregnancy-Specific β-1-Glycoprotein 6 (PSG6) belongs to the immunoglobulin superfamily. PSG6 is a secreted protein that includes a 34 amino acid leader peptide and a 108 amino acid N domain. PSG6 contains one Ig-like V-type (immunoglobulin-like) domain and three Ig-like C2-type (immunoglobulin-like) domains. PSG6 is produced in high quantities during pregnancy. The N-terminal domain of PSG6 is sufficient for the induction of monocyte cytokine secretion. |
AA Sequence : | QVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRET VYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAV RLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDP VTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRIL ILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNP PAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSGPCHGNQTESH VDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | PSG6 pregnancy specific beta-1-glycoprotein 6 [ Homo sapiens ] |
Official Symbol | PSG6 |
Synonyms | PSG6; pregnancy specific beta-1-glycoprotein 6; pregnancy-specific beta-1-glycoprotein 6; PS-beta-G-6; PS-beta-G-10; PS-beta-G-12; pregnancy-specific beta-1-glycoprotein 10; pregnancy-specific beta-1-glycoprotein 12; PSG10; PSBG-6; PSBG-10; PSBG-12; |
Gene ID | 5675 |
mRNA Refseq | NM_001031850 |
Protein Refseq | NP_001027020 |
MIM | 176395 |
UniProt ID | Q00889 |
Chromosome Location | 19q13.2 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
PSG6-7367H | Recombinant Human PSG6, His tagged | +Inquiry |
PSG6-201H | Active Recombinant Human PSG6 protein, His-tagged | +Inquiry |
PSG6-182H | Recombinant Human PSG6, His-tagged | +Inquiry |
PSG6-0254H | Recombinant Human PSG6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSG6-406HCL | Recombinant Human PSG6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSG6 Products
Required fields are marked with *
My Review for All PSG6 Products
Required fields are marked with *