Recombinant Human PSMC1, His-tagged

• Cat.No.: PSMC1-30430TH
• Product Overview: Recombinant fragment, corresponding to amino acids 225-440 of Human Proteasome 19S S4 with N terminal His tag; Predicted MWt 25 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 225-440 a.a.
• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit and a 20S core alpha subunit interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. This subunit also interacts with the adenovirus E1A protein and this interaction alters the activity of the proteasome. Finally, this subunit interacts with ataxin-7, suggesting a role for the proteasome in the development of spinocerebellar ataxia type 7, a progressive neurodegenerative disorder.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 77 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGP KLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGE REIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPA LIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDV TLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNED FKKSKENVLYKKQEGTPEGLYL

Gene Information

• Gene Name: PSMC1 proteasome (prosome, macropain) 26S subunit, ATPase, 1 [ Homo sapiens ]
• Official Symbol: PSMC1
• Synonyms: PSMC1; proteasome (prosome, macropain) 26S subunit, ATPase, 1; 26S protease regulatory subunit 4; p56; S4
• Gene ID: 5700
• mRNA Refseq: NM_002802
• Protein Refseq: NP_002793
• MIM: 602706
• Uniprot ID: P62191
• Chromosome Location: 14q32.11
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: ATP binding; ATPase activity; hydrolase activity; nucleotide binding; protein binding