| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-289aa |
| Description : |
Catalyzes the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. |
| Form : |
Liquid in. 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 2mM DTT, 10% glycerol |
| Bio-activity : |
Specific activity is > 120 unit/mg, and is defined as the amount of enzyme that phosphorolysis of 1.0 μmole of inosine with inorganic phosphate per minute at pH 7.5 at 25 centigrade. |
| Molecular Mass : |
34.2 kDa (309aa) confirmed by MALDI-TOF |
| AASequence : |
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
