Recombinant Human PUSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PUSL1-3805H
Product Overview : PUSL1 MS Standard C13 and N15-labeled recombinant protein (NP_699170) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PUSL1 (Pseudouridine Synthase Like 1) is a Protein Coding gene. Diseases associated with PUSL1 include Myopathy, Lactic Acidosis, And Sideroblastic Anemia. Gene Ontology (GO) annotations related to this gene include RNA binding and pseudouridine synthase activity. An important paralog of this gene is PUS3.
Molecular Mass : 33.2 kDa
AA Sequence : MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PUSL1 pseudouridylate synthase-like 1 [ Homo sapiens (human) ]
Official Symbol PUSL1
Synonyms PUSL1; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; FLJ90811; tRNA-uridine isomerase-like 1; tRNA pseudouridylate synthase-like 1;
Gene ID 126789
mRNA Refseq NM_153339
Protein Refseq NP_699170
UniProt ID Q8N0Z8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PUSL1 Products

Required fields are marked with *

My Review for All PUSL1 Products

Required fields are marked with *

0
cart-icon