Recombinant Human PUSL1 protein, GST-tagged
Cat.No. : | PUSL1-315H |
Product Overview : | Recombinant Human PUSL1(1 a.a. - 303 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-303 a.a. |
Description : | Pseudouridylate synthase-like played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNA AHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERN LCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFE SQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFG SHG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PUSL1 pseudouridylate synthase-like 1 [ Homo sapiens ] |
Official Symbol | PUSL1 |
Synonyms | PUSL1; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; FLJ90811; tRNA-uridine isomerase-like 1; tRNA pseudouridylate synthase-like 1; |
Gene ID | 126789 |
mRNA Refseq | NM_153339 |
Protein Refseq | NP_699170 |
MIM | |
UniProt ID | Q8N0Z8 |
Chromosome Location | 1p36.33 |
Function | RNA binding; isomerase activity; pseudouridine synthase activity; |
◆ Recombinant Proteins | ||
PUSL1-3805H | Recombinant Human PUSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PUSL1-316H | Recombinant Human PUSL1 protein, MYC/DDK-tagged | +Inquiry |
PUSL1-5224C | Recombinant Chicken PUSL1 | +Inquiry |
PUSL1-4118HFL | Recombinant Full Length Human PUSL1 protein, Flag-tagged | +Inquiry |
Pusl1-5263M | Recombinant Mouse Pusl1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PUSL1-2659HCL | Recombinant Human PUSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PUSL1 Products
Required fields are marked with *
My Review for All PUSL1 Products
Required fields are marked with *