"PUSL1" Related Products

Expand
Expand

Recombinant Human PUSL1 protein, GST-tagged

Cat.No.: PUSL1-315H
Product Overview: Recombinant Human PUSL1(1 a.a. - 303 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Pseudouridylate synthase-like played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 59.6 kDa
AA Sequence: MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNA AHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERN LCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFE SQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFG SHG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PUSL1 pseudouridylate synthase-like 1 [ Homo sapiens ]
Official Symbol: PUSL1
Synonyms: PUSL1; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; FLJ90811; tRNA-uridine isomerase-like 1; tRNA pseudouridylate synthase-like 1;
Gene ID: 126789
mRNA Refseq: NM_153339
Protein Refseq: NP_699170
MIM:
UniProt ID: Q8N0Z8
Chromosome Location: 1p36.33
Function: RNA binding; isomerase activity; pseudouridine synthase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.