Recombinant Human RAB12 protein, His&Myc-tagged
Cat.No. : | RAB12-5744H |
Product Overview : | Recombinant Human RAB12 protein(Q6IQ22)(1-244aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-244a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC |
Gene Name | RAB12 RAB12, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB12 |
Gene ID | 201475 |
mRNA Refseq | NM_001025300.2 |
Protein Refseq | NP_001020471.2 |
UniProt ID | Q6IQ22 |
◆ Recombinant Proteins | ||
RAB12-13788M | Recombinant Mouse RAB12 Protein | +Inquiry |
RAB12-5744H | Recombinant Human RAB12 protein, His&Myc-tagged | +Inquiry |
RAB12-218H | Recombinant Human RAB12 Protein, MYC/DDK-tagged | +Inquiry |
RAB12-803HFL | Recombinant Full Length Human RAB12 Protein, C-Flag-tagged | +Inquiry |
RAB12-7340M | Recombinant Mouse RAB12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB12 Products
Required fields are marked with *
My Review for All RAB12 Products
Required fields are marked with *
0
Inquiry Basket