Recombinant Human RAB24, His-tagged

Cat.No. : RAB24-31280TH
Product Overview : Recombinant full-length Human Rab24 with a N terminal His tag; 227 amino acids with a predicted MWt 25.7 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 227 amino acids
Description : RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al.
Conjugation : HIS
Molecular Weight : 25.700kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Sequence Similarities : Belongs to the small GTPase superfamily. Rab family.
Gene Name RAB24 RAB24, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB24
Synonyms RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24;
Gene ID 53917
mRNA Refseq NM_001031677
Protein Refseq NP_001026847
MIM 612415
Uniprot ID Q969Q5
Chromosome Location 5q35.3
Function GTP binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB24 Products

Required fields are marked with *

My Review for All RAB24 Products

Required fields are marked with *

0
cart-icon
0
compare icon