Recombinant Human RAB24, His-tagged
| Cat.No. : | RAB24-31280TH |
| Product Overview : | Recombinant full-length Human Rab24 with a N terminal His tag; 227 amino acids with a predicted MWt 25.7 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 227 amino acids |
| Description : | RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al. |
| Conjugation : | HIS |
| Molecular Weight : | 25.700kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
| Gene Name | RAB24 RAB24, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB24 |
| Synonyms | RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24; |
| Gene ID | 53917 |
| mRNA Refseq | NM_001031677 |
| Protein Refseq | NP_001026847 |
| MIM | 612415 |
| Uniprot ID | Q969Q5 |
| Chromosome Location | 5q35.3 |
| Function | GTP binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| RAB24-166H | Recombinant Human RAB24 protein, T7/His-tagged | +Inquiry |
| RAB24-2108H | Recombinant Human RAB24, GST-tagged | +Inquiry |
| RAB24-812H | Recombinant Human RAB24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Rab24-1104M | Active Recombinant Mouse RAB24, member RAS oncogene family, GST-tagged | +Inquiry |
| RAB24-2496H | Recombinant Human RAB24, Member RAS Oncogene Family, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB24-2616HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
| RAB24-2617HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB24 Products
Required fields are marked with *
My Review for All RAB24 Products
Required fields are marked with *



