Recombinant Human RAB39B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB39B-4261H |
Product Overview : | RAB39B MS Standard C13 and N15-labeled recombinant protein (NP_741995) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB39B RAB39B, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB39B |
Synonyms | RAB39B; RAB39B, member RAS oncogene family; ras-related protein Rab-39B; MRX72; |
Gene ID | 116442 |
mRNA Refseq | NM_171998 |
Protein Refseq | NP_741995 |
MIM | 300774 |
UniProt ID | Q96DA2 |
◆ Recombinant Proteins | ||
RAB39B-2118H | Recombinant Human RAB39B, GST-tagged | +Inquiry |
RAB39B-3750R | Recombinant Rhesus monkey RAB39B Protein, His-tagged | +Inquiry |
Rab39b-5316M | Recombinant Mouse Rab39b Protein, Myc/DDK-tagged | +Inquiry |
RAB39B-598H | Recombinant Human RAB39B, member RAS oncogene family, His-tagged | +Inquiry |
RAB39B-4261H | Recombinant Human RAB39B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB39B-2599HCL | Recombinant Human RAB39B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB39B Products
Required fields are marked with *
My Review for All RAB39B Products
Required fields are marked with *