Recombinant Human RAB39B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB39B-4261H
Product Overview : RAB39B MS Standard C13 and N15-labeled recombinant protein (NP_741995) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability.
Molecular Mass : 24.6 kDa
AA Sequence : MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB39B RAB39B, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB39B
Synonyms RAB39B; RAB39B, member RAS oncogene family; ras-related protein Rab-39B; MRX72;
Gene ID 116442
mRNA Refseq NM_171998
Protein Refseq NP_741995
MIM 300774
UniProt ID Q96DA2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB39B Products

Required fields are marked with *

My Review for All RAB39B Products

Required fields are marked with *

0
cart-icon