Recombinant Human RAB42 Protein, GST-tagged
| Cat.No. : | RAB42-5289H |
| Product Overview : | Human MGC45806 partial ORF ( NP_689517, 46 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RAB42 (RAB42, Member RAS Oncogene Family) is a Protein Coding gene. Among its related pathways are RAB geranylgeranylation and Metabolism of proteins. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is RAB39B. |
| Molecular Mass : | 32.34 kDa |
| AA Sequence : | SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RAB42 RAB42, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB42 |
| Synonyms | RAB42; RAB42, member RAS oncogene family; RAB42, member RAS homolog family; putative Ras-related protein Rab-42; MGC45806; RP4-669K10.6; |
| Gene ID | 115273 |
| mRNA Refseq | NM_001193532 |
| Protein Refseq | NP_001180461 |
| UniProt ID | Q8N4Z0 |
| ◆ Recombinant Proteins | ||
| RAB42-5289H | Recombinant Human RAB42 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB42-1455HCL | Recombinant Human RAB42 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB42 Products
Required fields are marked with *
My Review for All RAB42 Products
Required fields are marked with *
