Recombinant Human RAB42 Protein, GST-tagged

Cat.No. : RAB42-5289H
Product Overview : Human MGC45806 partial ORF ( NP_689517, 46 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RAB42 (RAB42, Member RAS Oncogene Family) is a Protein Coding gene. Among its related pathways are RAB geranylgeranylation and Metabolism of proteins. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is RAB39B.
Molecular Mass : 32.34 kDa
AA Sequence : SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RAB42 RAB42, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB42
Synonyms RAB42; RAB42, member RAS oncogene family; RAB42, member RAS homolog family; putative Ras-related protein Rab-42; MGC45806; RP4-669K10.6;
Gene ID 115273
mRNA Refseq NM_001193532
Protein Refseq NP_001180461
UniProt ID Q8N4Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB42 Products

Required fields are marked with *

My Review for All RAB42 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon