Recombinant Human RAB4A protein, T7-tagged
| Cat.No. : | RAB4A-208H |
| Product Overview : | Recombinant human RAB4A ( 218 aa, Isoform-I ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 218 a.a. |
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFGSTSMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIIN VGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPR RAQAPNAQECGC |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB4A |
| Synonyms | RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4; |
| Gene ID | 5867 |
| mRNA Refseq | NM_004578 |
| Protein Refseq | NP_004569 |
| MIM | 179511 |
| UniProt ID | P20338 |
| Chromosome Location | 1q42-q43 |
| Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Insulin Signaling, organism-specific biosystem; Signaling events mediated by TCPTP, organism-specific biosystem; |
| Function | ATPase activator activity; ATPase binding; GDP binding; GTP binding; GTPase activity; ionotropic glutamate receptor binding; nucleotide binding; protein binding; protein transporter activity; syntaxin binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB4A Products
Required fields are marked with *
My Review for All RAB4A Products
Required fields are marked with *



