Recombinant Human RAB4A protein, T7-tagged

Cat.No. : RAB4A-208H
Product Overview : Recombinant human RAB4A ( 218 aa, Isoform-I ) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 218 a.a.
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFGSTSMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIIN VGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPR RAQAPNAQECGC
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB4A
Synonyms RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4;
Gene ID 5867
mRNA Refseq NM_004578
Protein Refseq NP_004569
MIM 179511
UniProt ID P20338
Chromosome Location 1q42-q43
Pathway Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Insulin Signaling, organism-specific biosystem; Signaling events mediated by TCPTP, organism-specific biosystem;
Function ATPase activator activity; ATPase binding; GDP binding; GTP binding; GTPase activity; ionotropic glutamate receptor binding; nucleotide binding; protein binding; protein transporter activity; syntaxin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB4A Products

Required fields are marked with *

My Review for All RAB4A Products

Required fields are marked with *

0
cart-icon
0
compare icon