"RAB4A" Related Products

Expand
Expand

Recombinant Human RAB4A protein, T7-tagged

Cat.No.: RAB4A-208H
Product Overview: Recombinant human RAB4A ( 218 aa, Isoform-I ) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFGSTSMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIIN VGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPR RAQAPNAQECGC
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ]
Official Symbol: RAB4A
Synonyms: RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4;
Gene ID: 5867
mRNA Refseq: NM_004578
Protein Refseq: NP_004569
MIM: 179511
UniProt ID: P20338
Chromosome Location: 1q42-q43
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Insulin Signaling, organism-specific biosystem; Signaling events mediated by TCPTP, organism-specific biosystem;
Function: ATPase activator activity; ATPase binding; GDP binding; GTP binding; GTPase activity; ionotropic glutamate receptor binding; nucleotide binding; protein binding; protein transporter activity; syntaxin binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.