Recombinant Human RABGAP1 protein, GST-tagged
Cat.No. : | RABGAP1-2140H |
Product Overview : | Recombinant Human RABGAP1 protein(697-997 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 697-997 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | DDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RABGAP1 RAB GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol | RABGAP1 |
Synonyms | RABGAP1; RAB GTPase activating protein 1; rab GTPase-activating protein 1; GAPCenA; rab6 GTPase activating protein (GAP and centrosome associated); TBC1 domain family; member 11; TBC1D11; TBC1 domain family, member 11; GAP and centrosome-associated protein; rab6 GTPase-activating protein GAPCenA; Rab6 GTPase activating protein, GAPCenA; rab6 GTPase activating protein (GAP and centrosome-associated); GAPCENA; RP11-123N4.2; DKFZp586D2123; |
Gene ID | 23637 |
mRNA Refseq | NM_012197 |
Protein Refseq | NP_036329 |
UniProt ID | Q9Y3P9 |
◆ Recombinant Proteins | ||
RABGAP1-2140H | Recombinant Human RABGAP1 protein, GST-tagged | +Inquiry |
RABGAP1-13847M | Recombinant Mouse RABGAP1 Protein | +Inquiry |
RABGAP1-7370M | Recombinant Mouse RABGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABGAP1-1458HCL | Recombinant Human RABGAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABGAP1 Products
Required fields are marked with *
My Review for All RABGAP1 Products
Required fields are marked with *