Recombinant Human RABGAP1 protein, GST-tagged
| Cat.No. : | RABGAP1-2140H | 
| Product Overview : | Recombinant Human RABGAP1 protein(697-997 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 697-997 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. | 
| AASequence : | DDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | RABGAP1 RAB GTPase activating protein 1 [ Homo sapiens ] | 
| Official Symbol | RABGAP1 | 
| Synonyms | RABGAP1; RAB GTPase activating protein 1; rab GTPase-activating protein 1; GAPCenA; rab6 GTPase activating protein (GAP and centrosome associated); TBC1 domain family; member 11; TBC1D11; TBC1 domain family, member 11; GAP and centrosome-associated protein; rab6 GTPase-activating protein GAPCenA; Rab6 GTPase activating protein, GAPCenA; rab6 GTPase activating protein (GAP and centrosome-associated); GAPCENA; RP11-123N4.2; DKFZp586D2123; | 
| Gene ID | 23637 | 
| mRNA Refseq | NM_012197 | 
| Protein Refseq | NP_036329 | 
| UniProt ID | Q9Y3P9 | 
| ◆ Recombinant Proteins | ||
| RABGAP1-13847M | Recombinant Mouse RABGAP1 Protein | +Inquiry | 
| RABGAP1-7370M | Recombinant Mouse RABGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RABGAP1-2140H | Recombinant Human RABGAP1 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| RABGAP1-1458HCL | Recombinant Human RABGAP1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABGAP1 Products
Required fields are marked with *
My Review for All RABGAP1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            