Recombinant Human RABL4 protein, His-tagged
Cat.No. : | RABL4-2146H |
Product Overview : | Recombinant Human RABL4 (1-186aa) fussed with His tag at N-terminal was expressed in E. coli. |
Availability | July 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-186aa |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
Molecular Mass : | 26 kDa |
AA Sequence : | MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEML DKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECF ETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | IFT27 intraflagellar transport 27 homolog (Chlamydomonas) [ Homo sapiens ] |
Official Symbol | IFT27 |
Synonyms | IFT27; intraflagellar transport 27 homolog (Chlamydomonas); RAB, member of RAS oncogene family like 4 , RABL4; intraflagellar transport protein 27 homolog; RAYL; rab-like protein 4; RAB, member of RAS oncogene family-like 4; RABL4; FLJ33389; DKFZp686M22208; |
Gene ID | 11020 |
mRNA Refseq | NM_001177701 |
Protein Refseq | NP_001171172 |
MIM | 615870 |
UniProt ID | Q9BW83 |
Chromosome Location | 22q13.1 |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
IFT27-4451M | Recombinant Mouse IFT27 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT27-4793C | Recombinant Chicken IFT27 | +Inquiry |
Ift27-3484M | Recombinant Mouse Ift27 Protein, Myc/DDK-tagged | +Inquiry |
IFT27-1972HFL | Recombinant Full Length Human IFT27 Protein, C-Flag-tagged | +Inquiry |
IFT27-1886Z | Recombinant Zebrafish IFT27 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFT27-2568HCL | Recombinant Human RABL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT27 Products
Required fields are marked with *
My Review for All IFT27 Products
Required fields are marked with *