Recombinant Human RABL4 protein, His-tagged
| Cat.No. : | RABL4-2146H |
| Product Overview : | Recombinant Human RABL4 (1-186aa) fussed with His tag at N-terminal was expressed in E. coli. |
| Availability | December 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-186aa |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
| Molecular Mass : | 26 kDa |
| AA Sequence : | MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEML DKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECF ETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | IFT27 intraflagellar transport 27 homolog (Chlamydomonas) [ Homo sapiens ] |
| Official Symbol | IFT27 |
| Synonyms | IFT27; intraflagellar transport 27 homolog (Chlamydomonas); RAB, member of RAS oncogene family like 4 , RABL4; intraflagellar transport protein 27 homolog; RAYL; rab-like protein 4; RAB, member of RAS oncogene family-like 4; RABL4; FLJ33389; DKFZp686M22208; |
| Gene ID | 11020 |
| mRNA Refseq | NM_001177701 |
| Protein Refseq | NP_001171172 |
| MIM | 615870 |
| UniProt ID | Q9BW83 |
| Chromosome Location | 22q13.1 |
| Function | GTP binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| IFT27-4793C | Recombinant Chicken IFT27 | +Inquiry |
| IFT27-4794C | Recombinant Chicken IFT27 | +Inquiry |
| IFT27-8051M | Recombinant Mouse IFT27 Protein | +Inquiry |
| IFT27-1972HFL | Recombinant Full Length Human IFT27 Protein, C-Flag-tagged | +Inquiry |
| IFT27-1153H | Recombinant Human IFT27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFT27-2568HCL | Recombinant Human RABL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT27 Products
Required fields are marked with *
My Review for All IFT27 Products
Required fields are marked with *
