Recombinant Human RABL5 protein, His-tagged
Cat.No. : | RABL5-2955H |
Product Overview : | Recombinant Human RABL5 protein(1 - 108 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 108 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RABL5 RAB, member RAS oncogene family-like 5 [ Homo sapiens ] |
Official Symbol | RABL5 |
Synonyms | RABL5; RAB, member RAS oncogene family-like 5; rab-like protein 5; DKFZp761N0823; FLJ13225; FLJ14117; RAB, member of RAS oncogene family-like 5; |
Gene ID | 64792 |
mRNA Refseq | NM_001130820 |
Protein Refseq | NP_001124292 |
UniProt ID | Q9H7X7 |
◆ Recombinant Proteins | ||
RABL5-4907R | Recombinant Rat RABL5 Protein | +Inquiry |
RABL5-7598H | Recombinant Human RABL5, His-tagged | +Inquiry |
RABL5-13855M | Recombinant Mouse RABL5 Protein | +Inquiry |
RABL5-3586R | Recombinant Rhesus Macaque RABL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RABL5-2955H | Recombinant Human RABL5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABL5-2567HCL | Recombinant Human RABL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABL5 Products
Required fields are marked with *
My Review for All RABL5 Products
Required fields are marked with *
0
Inquiry Basket