Recombinant Human RAP2B
Cat.No. : | RAP2B-30505TH |
Product Overview : | Recombinant Full Length Human RAP2B expressed in Saccharomyces cerevisiae; amino acids 1-183; 183 amino acids, 20.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-183 a.a. |
Description : | This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFY RKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEI VRQMNYAAQPNGDEGCCSACVIL |
Full Length : | Full L. |
Gene Name | RAP2B RAP2B, member of RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAP2B |
Synonyms | RAP2B; RAP2B, member of RAS oncogene family; ras-related protein Rap-2b; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; small GTP binding protein; |
Gene ID | 5912 |
mRNA Refseq | NM_002886 |
Protein Refseq | NP_002877 |
MIM | 179541 |
Uniprot ID | P61225 |
Chromosome Location | 3q25.2 |
Function | GTP binding; GTPase activity; nucleotide binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
RAP2B-30505TH | Recombinant Human RAP2B | +Inquiry |
RAP2B-3604R | Recombinant Rhesus Macaque RAP2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Rap2b-5375M | Recombinant Mouse Rap2b Protein, Myc/DDK-tagged | +Inquiry |
RAP2B-2405C | Recombinant Chicken RAP2B | +Inquiry |
RAP2B-224Z | Recombinant Zebrafish RAP2B | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAP2B-2524HCL | Recombinant Human RAP2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAP2B Products
Required fields are marked with *
My Review for All RAP2B Products
Required fields are marked with *