Recombinant Human RAPGEF2 protein, His-tagged

• Cat.No.: RAPGEF2-7143H
• Product Overview: Recombinant Human RAPGEF2 protein(1255-1400 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1255-1400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: RAPGEF2
• Synonyms: RAPGEF2; Rap guanine nucleotide exchange factor (GEF) 2; PDZ domain containing guanine nucleotide exchange factor (GEF) 1 , PDZGEF1; rap guanine nucleotide exchange factor 2; DKFZP586O1422; KIAA0313; PDZ GEF1; RA GEF; Rap GEP; RA(Ras/Rap1A-associating)-GEF; neural RAP guanine nucleotide exchange protein; PDZ domain-containing guanine nucleotide exchange factor 1; PDZ domain containing guanine nucleotide exchange factor (GEF) 1; RA-GEF; NRAPGEP; PDZGEF1; Rap-GEP; CNrasGEF; PDZ-GEF1; nRap GEP
• Gene ID: 9693
• mRNA Refseq: NM_014247
• Protein Refseq: NP_055062
• MIM: 609530
• UniProt ID: Q9Y4G8