Recombinant Human RASA3 protein, His-tagged

• Cat.No.: RASA3-2187H
• Product Overview: Recombinant Human RASA3 protein(563-834 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 563-834 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: RASA3 RAS p21 protein activator 3 [ Homo sapiens ]
• Official Symbol: RASA3
• Synonyms: RASA3; RAS p21 protein activator 3; ras GTPase-activating protein 3; GAP1IP4BP; GAPIII; GAP1(IP4BP); ins P4-binding protein; GTPase activating protein III; Ins(1,3,4,5)P4-binding protein; inositol 1,3,4,5-tetrakisphosphate-binding protein; MGC46517; MGC47588
• Gene ID: 22821
• mRNA Refseq: NM_007368
• Protein Refseq: NP_031394
• MIM: 605182
• UniProt ID: Q14644