Recombinant Human RBAKDN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RBAKDN-543H |
Product Overview : | LOC389458 MS Standard C13 and N15-labeled recombinant protein (NP_976327) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RBAKDN (RBAK Downstream Neighbor) is an RNA Gene, and is affiliated with the lncRNA class. |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MLTPRKSFRTCSKASGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGEHGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RBAKDN RBAK downstream neighbor [ Homo sapiens (human) ] |
Official Symbol | RBAKDN |
Synonyms | RBAKDN; RBAK downstream neighbor; MGC35170 |
Gene ID | 389458 |
mRNA Refseq | NM_203393 |
Protein Refseq | NP_976327 |
UniProt ID | A6NC62 |
◆ Recombinant Proteins | ||
RBAKDN-543H | Recombinant Human RBAKDN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBAKDN-723H | Recombinant Human LOC389458 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBAKDN Products
Required fields are marked with *
My Review for All RBAKDN Products
Required fields are marked with *