Recombinant Human RBAKDN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBAKDN-543H
Product Overview : LOC389458 MS Standard C13 and N15-labeled recombinant protein (NP_976327) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RBAKDN (RBAK Downstream Neighbor) is an RNA Gene, and is affiliated with the lncRNA class.
Molecular Mass : 12.7 kDa
AA Sequence : MLTPRKSFRTCSKASGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGEHGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBAKDN RBAK downstream neighbor [ Homo sapiens (human) ]
Official Symbol RBAKDN
Synonyms RBAKDN; RBAK downstream neighbor; MGC35170
Gene ID 389458
mRNA Refseq NM_203393
Protein Refseq NP_976327
UniProt ID A6NC62

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBAKDN Products

Required fields are marked with *

My Review for All RBAKDN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon