Recombinant Human RBFOX2 protein, GST-tagged
Cat.No. : | RBFOX2-210H |
Product Overview : | Recombinant Human RBFOX2(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-100 a.a. |
Description : | This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNS PSTQNGSLTTEGGAQTDGQQSQTQS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RBFOX2 RNA binding protein, fox-1 homolog (C. elegans) 2 [ Homo sapiens ] |
Official Symbol | RBFOX2 |
Synonyms | RBFOX2; RNA binding protein, fox-1 homolog (C. elegans) 2; RBM9, RNA binding motif protein 9; RNA binding protein fox-1 homolog 2; FOX 2; hexaribonucleotide binding protein 2; HNRBP2; HRNBP2; fox-1 homolog B; fox-1 homologue; RNA-binding motif protein 9; hexaribonucleotide-binding protein 2; repressor of tamoxifen transcriptional activity; RTA; fxh; FOX2; RBM9; Fox-2; dJ106I20.3; |
Gene ID | 23543 |
mRNA Refseq | NM_014309 |
Protein Refseq | NP_055124 |
MIM | 612149 |
UniProt ID | O43251 |
Chromosome Location | 22q12-q13 |
Function | RNA binding; nucleotide binding; protein binding; transcription corepressor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
Rbfox2-5407M | Recombinant Mouse Rbfox2 Protein, Myc/DDK-tagged | +Inquiry |
RBFOX2-209H | Recombinant Human RBFOX2 protein, GST-tagged | +Inquiry |
RBFOX2-4613R | Recombinant Rat RBFOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBFOX2-3808R | Recombinant Rhesus monkey RBFOX2 Protein, His-tagged | +Inquiry |
RBFOX2-211H | Recombinant Human RBFOX2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBFOX2-2464HCL | Recombinant Human RBM9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBFOX2 Products
Required fields are marked with *
My Review for All RBFOX2 Products
Required fields are marked with *