Recombinant Human RBM3

• Cat.No.: RBM3-31231TH
• Product Overview: Recombinant fragment of Human RBM3 protein with an N terminal proprietary tag. Predicted MWt 34.43 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 80 amino acids
• Description: This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria.
• Molecular Weight: 34.430kDa
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
• Sequence Similarities: Contains 1 RRM (RNA recognition motif) domain.

Gene Information

• Gene Name: RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ]
• Official Symbol: RBM3
• Synonyms: RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL
• Gene ID: 5935
• mRNA Refseq: NM_006743
• Protein Refseq: NP_006734
• MIM: 300027
• Uniprot ID: P98179
• Chromosome Location: Xp11.2
• Function: RNA binding; nucleotide binding; ribosomal large subunit binding