Recombinant Human RBM3

Cat.No. : RBM3-31231TH
Product Overview : Recombinant fragment of Human RBM3 protein with an N terminal proprietary tag. Predicted MWt 34.43 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 80 amino acids
Description : This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria.
Molecular Weight : 34.430kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
Sequence Similarities : Contains 1 RRM (RNA recognition motif) domain.
Gene Name RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ]
Official Symbol RBM3
Synonyms RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL;
Gene ID 5935
mRNA Refseq NM_006743
Protein Refseq NP_006734
MIM 300027
Uniprot ID P98179
Chromosome Location Xp11.2
Function RNA binding; nucleotide binding; ribosomal large subunit binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM3 Products

Required fields are marked with *

My Review for All RBM3 Products

Required fields are marked with *

0
cart-icon