Recombinant Human RCN3 protein, GST-tagged
Cat.No. : | RCN3-301362H |
Product Overview : | Recombinant Human RCN3 (71-161 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu71-Tyr161 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RCN3 reticulocalbin 3, EF-hand calcium binding domain [ Homo sapiens ] |
Official Symbol | RCN3 |
Synonyms | RCN3; reticulocalbin 3, EF-hand calcium binding domain; reticulocalbin-3; RLP49; reticulocabin; EF-hand calcium-binding protein RLP49; |
Gene ID | 57333 |
mRNA Refseq | NM_020650 |
Protein Refseq | NP_065701 |
UniProt ID | Q96D15 |
◆ Recombinant Proteins | ||
RCN3-6064H | Recombinant Human RCN3 Protein (Lys21-Leu328), C-His tagged | +Inquiry |
Rcn3-1138R | Recombinant Rat Rcn3 Protein, His-tagged | +Inquiry |
RCN3-382Z | Recombinant Zebrafish RCN3 | +Inquiry |
RCN3-3142H | Recombinant Human RCN3 protein, His-tagged | +Inquiry |
RCN3-301362H | Recombinant Human RCN3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCN3-1282HCL | Recombinant Human RCN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN3 Products
Required fields are marked with *
My Review for All RCN3 Products
Required fields are marked with *