Recombinant Human RECQL5 protein, GST-tagged

Cat.No. : RECQL5-26H
Product Overview : Recombinant Human RECQL5(1 a.a. - 435 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-435 a.a.
Description : The protein encoded by this gene is a helicase that is important for genome stability. The encoded protein also prevents aberrant homologous recombination by displacing RAD51 from ssDNA. Three transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 73.59 kDa
AA Sequence : MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAKGITIV VSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHL LSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANL FYDVQFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTL VQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRNDRDQVSFLI RKEVAKLQEKRGNKASDKATIMAFDALVTFCEELGRWGRGHGKSLRAAWCSQVVSRHAEL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name RECQL5 RecQ protein-like 5 [ Homo sapiens ]
Official Symbol RECQL5
Synonyms RECQL5; RecQ protein-like 5; ATP-dependent DNA helicase Q5; FLJ90603; RecQ protein 5; RecQ5; DNA helicase, RecQ-like type 5; RECQ5;
Gene ID 9400
mRNA Refseq NM_001003715
Protein Refseq NP_001003715
MIM 603781
UniProt ID O94762
Chromosome Location 17q25
Function ATP binding; ATP-dependent helicase activity; DNA helicase activity; hydrolase activity; nucleic acid binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RECQL5 Products

Required fields are marked with *

My Review for All RECQL5 Products

Required fields are marked with *

0
cart-icon