Recombinant Human RECQL5 protein, GST-tagged
Cat.No. : | RECQL5-26H |
Product Overview : | Recombinant Human RECQL5(1 a.a. - 435 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-435 a.a. |
Description : | The protein encoded by this gene is a helicase that is important for genome stability. The encoded protein also prevents aberrant homologous recombination by displacing RAD51 from ssDNA. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 73.59 kDa |
AA Sequence : | MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAKGITIV VSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHL LSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANL FYDVQFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTL VQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRNDRDQVSFLI RKEVAKLQEKRGNKASDKATIMAFDALVTFCEELGRWGRGHGKSLRAAWCSQVVSRHAEL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RECQL5 RecQ protein-like 5 [ Homo sapiens ] |
Official Symbol | RECQL5 |
Synonyms | RECQL5; RecQ protein-like 5; ATP-dependent DNA helicase Q5; FLJ90603; RecQ protein 5; RecQ5; DNA helicase, RecQ-like type 5; RECQ5; |
Gene ID | 9400 |
mRNA Refseq | NM_001003715 |
Protein Refseq | NP_001003715 |
MIM | 603781 |
UniProt ID | O94762 |
Chromosome Location | 17q25 |
Function | ATP binding; ATP-dependent helicase activity; DNA helicase activity; hydrolase activity; nucleic acid binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RECQL5-2244H | Recombinant Human RECQL5, GST-tagged | +Inquiry |
RECQL5-4983R | Recombinant Rat RECQL5 Protein | +Inquiry |
RECQL5-26H | Recombinant Human RECQL5 protein, GST-tagged | +Inquiry |
RECQL5-4642R | Recombinant Rat RECQL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RECQL5-3748H | Recombinant Human RECQL5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RECQL5-1492HCL | Recombinant Human RECQL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RECQL5 Products
Required fields are marked with *
My Review for All RECQL5 Products
Required fields are marked with *