Recombinant Human REG3A protein, GST-tagged
| Cat.No. : | REG3A-3417H |
| Product Overview : | Recombinant Human REG3A protein(Q06141)(27-175aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 27-175aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | REG3A regenerating islet-derived 3 alpha [ Homo sapiens ] |
| Official Symbol | REG3A |
| Synonyms | REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565; |
| Gene ID | 5068 |
| mRNA Refseq | NM_002580 |
| Protein Refseq | NP_002571 |
| MIM | 167805 |
| UniProt ID | Q06141 |
| ◆ Recombinant Proteins | ||
| Reg3a-8749R | Recombinant Rat Reg3a protein, hFc-tagged | +Inquiry |
| Reg3a-837M | Recombinant Mouse Reg3a, His tagged | +Inquiry |
| Reg3a-2012M | Recombinant Mouse Reg3a Protein, His-tagged | +Inquiry |
| REG3A-4988R | Recombinant Rat REG3A Protein | +Inquiry |
| REG3A-2337H | Recombinant Full Length Human REG3A, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REG3A-2496HCL | Recombinant Human REG3A cell lysate | +Inquiry |
| REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
| REG3A-2691MCL | Recombinant Mouse REG3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3A Products
Required fields are marked with *
My Review for All REG3A Products
Required fields are marked with *



