Recombinant Human RERE

• Cat.No.: RERE-29593TH
• Product Overview: Recombinant fragment of Human RERE (amino acids 85-193) with N terminal proprietary tag, 37.62 kD.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 109 amino acids
• Description: This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 37.620kDa inclusive of tags
• Tissue specificity: Widely expressed. Expressed in tumor cell lines.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFI CSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQH LSEAGRGPVGSKRDHLLMNVKWYYRQSEV
• Sequence Similarities: Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain.

Gene Information

• Gene Name: RERE arginine-glutamic acid dipeptide (RE) repeats [ Homo sapiens ]
• Official Symbol: RERE
• Synonyms: RERE; arginine-glutamic acid dipeptide (RE) repeats; ATN1L; arginine-glutamic acid dipeptide repeats protein; ARG; ARP; DNB1; KIAA0458
• Gene ID: 473
• mRNA Refseq: NM_001042681
• Protein Refseq: NP_001036146
• MIM: 605226
• Uniprot ID: Q9P2R6
• Chromosome Location: 1p36.23
• Function: metal ion binding; poly-glutamine tract binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity