Recombinant Human RERE
Cat.No. : | RERE-29593TH |
Product Overview : | Recombinant fragment of Human RERE (amino acids 85-193) with N terminal proprietary tag, 37.62 kD. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 109 amino acids |
Description : | This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.620kDa inclusive of tags |
Tissue specificity : | Widely expressed. Expressed in tumor cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFI CSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQH LSEAGRGPVGSKRDHLLMNVKWYYRQSEV |
Sequence Similarities : | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
Gene Name | RERE arginine-glutamic acid dipeptide (RE) repeats [ Homo sapiens ] |
Official Symbol | RERE |
Synonyms | RERE; arginine-glutamic acid dipeptide (RE) repeats; ATN1L; arginine-glutamic acid dipeptide repeats protein; ARG; ARP; DNB1; KIAA0458; |
Gene ID | 473 |
mRNA Refseq | NM_001042681 |
Protein Refseq | NP_001036146 |
MIM | 605226 |
Uniprot ID | Q9P2R6 |
Chromosome Location | 1p36.23 |
Function | metal ion binding; poly-glutamine tract binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
RERE-4998R | Recombinant Rat RERE Protein | +Inquiry |
RERE-3851R | Recombinant Rhesus monkey RERE Protein, His-tagged | +Inquiry |
RERE-3668R | Recombinant Rhesus Macaque RERE Protein, His (Fc)-Avi-tagged | +Inquiry |
RERE-29593TH | Recombinant Human RERE | +Inquiry |
RERE-7527M | Recombinant Mouse RERE Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RERE Products
Required fields are marked with *
My Review for All RERE Products
Required fields are marked with *
0
Inquiry Basket