Recombinant Human RETREG1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RETREG1-002H
Product Overview : FAM134B MS Standard C13 and N15-labeled recombinant protein (NP_061873) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in susceptibility to vascular dementia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Molecular Mass : 39.3 kDa
AA Sequence : MPEGEDFGPGKSWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTILGSYIPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSGFLSNLLGGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RETREG1 reticulophagy regulator 1 [ Homo sapiens (human) ]
Official Symbol RETREG1
Synonyms RETREG1; reticulophagy regulator 1; FAM134B; JK-1; JK1; reticulophagy regulator 1; family with sequence similarity 134 member B; protein FAM134B; reticulophagy receptor 1; reticulophagy receptor FAM134B
Gene ID 54463
mRNA Refseq NM_019000
Protein Refseq NP_061873
MIM 613114
UniProt ID Q9H6L5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETREG1 Products

Required fields are marked with *

My Review for All RETREG1 Products

Required fields are marked with *

0
cart-icon