Recombinant Human RETREG1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: RETREG1-002H
• Product Overview: FAM134B MS Standard C13 and N15-labeled recombinant protein (NP_061873) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in susceptibility to vascular dementia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 39.3 kDa
• AA Sequence: MPEGEDFGPGKSWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTILGSYIPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSGFLSNLLGGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RETREG1 reticulophagy regulator 1 [ Homo sapiens (human) ]
• Official Symbol: RETREG1
• Synonyms: RETREG1; reticulophagy regulator 1; FAM134B; JK-1; JK1; reticulophagy regulator 1; family with sequence similarity 134 member B; protein FAM134B; reticulophagy receptor 1; reticulophagy receptor FAM134B
• Gene ID: 54463
• mRNA Refseq: NM_019000
• Protein Refseq: NP_061873
• MIM: 613114
• UniProt ID: Q9H6L5