Recombinant Human RGS13 protein, GST-tagged
| Cat.No. : | RGS13-2275H |
| Product Overview : | Recombinant Human RGS13 protein(1-159 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-159 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RGS13 regulator of G-protein signaling 13 [ Homo sapiens ] |
| Official Symbol | RGS13 |
| Synonyms | RGS13; regulator of G-protein signaling 13; regulator of G protein signalling 13; regulator of G-protein signalling 13; MGC17173; |
| Gene ID | 6003 |
| mRNA Refseq | NM_002927 |
| Protein Refseq | NP_002918 |
| MIM | 607190 |
| UniProt ID | O14921 |
| ◆ Recombinant Proteins | ||
| RGS13-2275H | Recombinant Human RGS13 protein, GST-tagged | +Inquiry |
| RGS13-688H | Recombinant Human RGS13 Protein, His-tagged | +Inquiry |
| RGS13-5606Z | Recombinant Zebrafish RGS13 | +Inquiry |
| Rgs13-5492M | Recombinant Mouse Rgs13 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RGS13-2384HCL | Recombinant Human RGS13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS13 Products
Required fields are marked with *
My Review for All RGS13 Products
Required fields are marked with *
