Recombinant Human RGS18 protein, GST-tagged
Cat.No. : | RGS18-301373H |
Product Overview : | Recombinant Human RGS18 (1-235 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu235 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RGS18 regulator of G-protein signaling 18 [ Homo sapiens ] |
Official Symbol | RGS18 |
Synonyms | RGS18; regulator of G-protein signaling 18; regulator of G protein signalling 18; RGS13; regulator of G-protein signalling 13; regulator of G-protein signalling 18; |
Gene ID | 64407 |
mRNA Refseq | NM_130782 |
Protein Refseq | NP_570138 |
MIM | 607192 |
UniProt ID | Q9NS28 |
◆ Recombinant Proteins | ||
RGS18-1183H | Recombinant Human RGS18 Protein, His-tagged | +Inquiry |
RGS18-4625C | Recombinant Chicken RGS18 | +Inquiry |
RGS18-301373H | Recombinant Human RGS18 protein, GST-tagged | +Inquiry |
RGS18-5016R | Recombinant Rat RGS18 Protein | +Inquiry |
RGS18-4675R | Recombinant Rat RGS18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS18-2381HCL | Recombinant Human RGS18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS18 Products
Required fields are marked with *
My Review for All RGS18 Products
Required fields are marked with *